PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim03g112930.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 334aa    MW: 36690.7 Da    PI: 6.8657
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim03g112930.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.58e-4061121262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         +++++kcprCdst+tkfCyynnysl+qPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+s
  Sopim03g112930.0.1  61 HDHSIKCPRCDSTHTKFCYYNNYSLTQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVS 121
                         57889*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-2955115IPR003851Zinc finger, Dof-type
PfamPF027014.5E-3363119IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.96665119IPR003851Zinc finger, Dof-type
PROSITE patternPS01361067103IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGITSLQVCM DSSDWLQGTI HEDCAGGMDS SSSPSGGDHI NNLMTCSRPI IVDQRRLRPP  60
HDHSIKCPRC DSTHTKFCYY NNYSLTQPRY FCKTCRRYWT KGGTLRNIPV GGGCRKNKKV  120
SSKKSSTNTN ESIPLSTTTT TNNNNIPEMP FPHHFMSSTN FGHHGNFMLE NQAPIIDFME  180
SKYEALVGSS SSTTTNSRLL NQDLFLGNGD NNNNIGMMMM SGSTSTNGFG HDHDNIVATN  240
YPFGITSIMD SSNNGNSFGM LLPYENHHEE VQNINAVEMK PNPKILSLEW HDDQLGSNKE  300
SSFGYYSGNG GLGSWTGLMN GNCYGSSATN PLV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755150.0HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004236531.10.0PREDICTED: dof zinc finger protein DOF5.6-like
TrEMBLK4BKE60.0K4BKE6_SOLLC; Uncharacterized protein
STRINGSolyc03g112930.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48952240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.19e-44Dof family protein